KIF12 anticorps (N-Term)

N° du produit ABIN634175

L’anticorps Lapin Polyclonal anti-KIF12 a été validé pour WB. Il convient pour détecter KIF12 dans des échantillons de Humain.

Aperçu rapide pour KIF12 anticorps (N-Term) (ABIN634175)

Antigène: KIF12 (Kinesin Family Member 12 (KIF12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KIF12 anticorps

Épitope: N-Term

Specificité: KIF12 antibody was raised against the N terminal of KIF12

Purification: Affinity purified

Immunogène: KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF12 Blocking Peptide, (ABIN5614344), is also available for use as a blocking control in assays to test for specificity of this KIF12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF12

Antigène: KIF12 (Kinesin Family Member 12 (KIF12))

Autre désignation: KIF12

Sujet: KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.

Poids moléculaire: 56 kDa (MW of target protein)