PIK3R4 anticorps (N-Term)

N° du produit ABIN634200

Cet anticorps anti-PIK3R4 Polyclonal Lapin (ABIN634200) détecte spécifiquement PIK3R4 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PIK3R4 anticorps (N-Term) (ABIN634200)

Antigène: PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4 (PIK3R4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIK3R4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIK3R4 anticorps

Épitope: N-Term

Specificité: PIK3 R4 antibody was raised against the N terminal of PIK3 4

Purification: Affinity purified

Immunogène: PIK3 R4 antibody was raised using the N terminal of PIK3 4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIK3R4 Blocking Peptide, (ABIN939096), is also available for use as a blocking control in assays to test for specificity of this PIK3R4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIK3R4

Antigène: PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4 (PIK3R4))

Autre désignation: PIK3R4

Sujet: The protein can regulate subunit of the PI3K complex and may regulate membrane trafficking late in the endocytic pathway.

Poids moléculaire: 153 kDa (MW of target protein)