MOS anticorps (Middle Region)

N° du produit ABIN634201

Cet anticorps Lapin Polyclonal détecte spécifiquement MOS dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MOS anticorps (Middle Region) (ABIN634201)

Antigène: MOS (Moloney Sarcoma Oncogene (MOS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MOS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MOS anticorps

Épitope: Middle Region

Specificité: MOS antibody was raised against the middle region of MOS

Purification: Affinity purified

Immunogène: MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MOS Blocking Peptide, (ABIN5614814), is also available for use as a blocking control in assays to test for specificity of this MOS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MOS

Antigène: MOS (Moloney Sarcoma Oncogene (MOS))

Autre désignation: MOS

Sujet: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.

Poids moléculaire: 38 kDa (MW of target protein)