CCNYL1 anticorps (N-Term)

N° du produit ABIN634208

Détail du produit anti-CCNYL1 anticorps

Antigène: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCNYL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cyclin Y-Like 1 antibody was raised against the N terminal of CCNYL1

Purification: Affinity purified

Immunogène: Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cyclin Y-Like 1 Blocking Peptide, catalog no. 33R-9359, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y-Like 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNYL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCNYL1

Antigène: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Autre désignation: Cyclin Y-Like 1 (CCNYL1 Produits)

Synonymes: anticorps 9630037P07Rik, anticorps AW554339, anticorps RGD1310683, anticorps ccnyl1, anticorps MGC153047, anticorps wu:fi41h04, anticorps CH1073-226M24.2, anticorps cyclin Y like 1, anticorps cyclin Y-like 1, anticorps microRNA 4775, anticorps cyclin Y like 1 L homeolog, anticorps cyclin Y like 1 S homeolog, anticorps CCNYL1, anticorps Ccnyl1, anticorps MIR4775, anticorps ccnyl1.L, anticorps ccnyl1.S, anticorps ccnyl1

Sujet: The specific function of CCNYL1 is not yet known.

Poids moléculaire: 33 kDa (MW of target protein)