TUBE1 anticorps (Middle Region)

N° du produit ABIN634213

Cet anticorps Lapin Polyclonal détecte spécifiquement TUBE1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TUBE1 anticorps (Middle Region) (ABIN634213)

Antigène: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBE1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TUBE1 anticorps

Épitope: Middle Region

Specificité: Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1

Purification: Affinity purified

Immunogène: Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Epsilon Tubulin 1 Blocking Peptide, (ABIN939163), is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBE1

Antigène: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Autre désignation: epsilon Tubulin 1

Sujet: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Dynamique des Microtubules