ANAPC7 anticorps (C-Term)

N° du produit ABIN634214

L’anticorps Lapin Polyclonal anti-ANAPC7 a été validé pour WB et IHC. Il convient pour détecter ANAPC7 dans des échantillons de Humain, Souris et Chien.

Aperçu rapide pour ANAPC7 anticorps (C-Term) (ABIN634214)

Antigène: ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANAPC7 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ANAPC7 anticorps

Épitope: C-Term

Specificité: ANAPC7 antibody was raised against the C terminal of ANAPC7

Purification: Affinity purified

Immunogène: ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANAPC7 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ANAPC7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANAPC7

Antigène: ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))

Autre désignation: ANAPC7

Sujet: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).

Poids moléculaire: 62 kDa (MW of target protein)