Interleukin enhancer-binding factor 3 (ILF3) (N-Term) anticorps

N° du produit ABIN634215

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour Interleukin enhancer-binding factor 3 (ILF3) (N-Term) anticorps (ABIN634215)

Antigène: Interleukin enhancer-binding factor 3 (ILF3)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit

Épitope: N-Term

Specificité: ILF3 antibody was raised against the N terminal of ILF3

Purification: Affinity purified

Immunogène: ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Information d'application

Indications d'application: WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ILF3 Blocking Peptide, (ABIN5614181), is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Interleukin enhancer-binding factor 3 (ILF3)

Autre désignation: ILF3

Sujet: ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity.

Poids moléculaire: 76 kDa (MW of target protein)

Pathways: M Phase