DHX16 anticorps

N° du produit ABIN634220

Détail du produit anti-DHX16 anticorps

Antigène: DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX16 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV

Information d'application

Indications d'application: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX16 Blocking Peptide, catalog no. 33R-4749, is also available for use as a blocking control in assays to test for specificity of this DHX16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX16

Antigène: DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))

Autre désignation: DHX16 (DHX16 Produits)

Synonymes: anticorps fa91b12, anticorps zgc:55590, anticorps wu:fa91b12, anticorps dbp2, anticorps ddx16, anticorps pro2014, anticorps prp2, anticorps prp8, anticorps prpf2, anticorps DHX16, anticorps DKFZp459L1130, anticorps DBP2, anticorps DDX16, anticorps PRO2014, anticorps PRP8, anticorps PRPF2, anticorps Prp2, anticorps 2410006N22Rik, anticorps Ddx16, anticorps mKIAA0577, anticorps Dbp2, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 16, anticorps DEAH-box helicase 16, anticorps putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, anticorps dhx16, anticorps DHX16, anticorps LOC100637149, anticorps Dhx16

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.

Poids moléculaire: 115 kDa (MW of target protein)