RAD54B anticorps

N° du produit ABIN634221

Détail du produit anti-RAD54B anticorps

Antigène: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD54B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD54B Blocking Peptide, catalog no. 33R-1865, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD54B

Antigène: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Autre désignation: RAD54B (RAD54B Produits)

Synonymes: anticorps RAD54B, anticorps im:7137737, anticorps im:7153525, anticorps fsbp, anticorps rdh54, anticorps RDH54, anticorps E130016E03Rik, anticorps Fsbp, anticorps RGD1306507, anticorps RAD54 homolog B (S. cerevisiae), anticorps RAD54 homolog B L homeolog, anticorps RAD54B, anticorps rad54b, anticorps rad54b.L, anticorps Rad54b

Sujet: RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA.

Poids moléculaire: 103 kDa (MW of target protein)