EIF4G2 anticorps (N-Term)

N° du produit ABIN634222

Cet anticorps Lapin Polyclonal détecte spécifiquement EIF4G2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour EIF4G2 anticorps (N-Term) (ABIN634222)

Antigène: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4G2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF4G2 anticorps

Épitope: N-Term

Specificité: EIF4 G2 antibody was raised against the N terminal of EIF4 2

Purification: Affinity purified

Immunogène: EIF4 G2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4G2 Blocking Peptide, (ABIN5613347), is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4G2

Antigène: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Autre désignation: EIF4G2

Sujet: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.

Poids moléculaire: 102 kDa (MW of target protein)