EIF4G2 anticorps (N-Term)
-
- Antigène Voir toutes EIF4G2 Anticorps
- EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF4G2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF4 G2 antibody was raised against the N terminal of EIF4 2
- Purification
- Affinity purified
- Immunogène
- EIF4 G2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL
- Top Product
- Discover our top product EIF4G2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF4G2 Blocking Peptide, catalog no. 33R-7233, is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))
- Autre désignation
- EIF4G2 (EIF4G2 Produits)
- Synonymes
- anticorps AAG1, anticorps DAP5, anticorps NAT1, anticorps P97, anticorps NAT1B, anticorps eif4g2, anticorps hm:zeh1307, anticorps wu:fa14h01, anticorps wu:fb44h01, anticorps wu:fb59c06, anticorps wu:fc21b05, anticorps EIF4G2, anticorps AA589388, anticorps DAP-5, anticorps E130105L11Rik, anticorps Nat1, anticorps Natm1, anticorps p97, anticorps NAT1A, anticorps im:7148615, anticorps wu:fb81f07, anticorps wu:fb82b06, anticorps wu:fb98h08, anticorps dap5, anticorps eif4g2.L, anticorps nat1, anticorps eukaryotic translation initiation factor 4 gamma 2, anticorps eukaryotic translation initiation factor 4, gamma 2b, anticorps eukaryotic translation initiation factor 4, gamma 2, anticorps eukaryotic translation initiation factor 4 gamma, 2, anticorps eIF4G-related protein NAT1, anticorps eukaryotic translation initiation factor 4, gamma 2a, anticorps eukaryotic translation initiation factor 4 gamma, 2 S homeolog, anticorps EIF4G2, anticorps eif4g2b, anticorps Eif4g2, anticorps nat1, anticorps eif4g2a, anticorps eif4g2.S
- Sujet
- Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.
- Poids moléculaire
- 102 kDa (MW of target protein)
-