FRK anticorps (N-Term)

N° du produit ABIN634237

Cet anticorps Lapin Polyclonal détecte spécifiquement FRK dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour FRK anticorps (N-Term) (ABIN634237)

Antigène: FRK (Fyn-Related Kinase (FRK))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FRK est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FRK anticorps

Épitope: N-Term

Specificité: FRK antibody was raised against the N terminal of FRK

Purification: Affinity purified

Immunogène: FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FRK Blocking Peptide, (ABIN940218), is also available for use as a blocking control in assays to test for specificity of this FRK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FRK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FRK

Antigène: FRK (Fyn-Related Kinase (FRK))

Autre désignation: FRK

Sujet: The specific function of FRK is not yet known.

Poids moléculaire: 58 kDa (MW of target protein)