TLK1 anticorps (N-Term)
-
- Antigène Voir toutes TLK1 Anticorps
- TLK1 (Tousled-Like Kinase 1 (TLK1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TLK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TLK1 antibody was raised against the N terminal of TLK1
- Purification
- Affinity purified
- Immunogène
- TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG
- Top Product
- Discover our top product TLK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TLK1 Blocking Peptide, catalog no. 33R-2724, is also available for use as a blocking control in assays to test for specificity of this TLK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TLK1 (Tousled-Like Kinase 1 (TLK1))
- Autre désignation
- TLK1 (TLK1 Produits)
- Synonymes
- anticorps PKU-beta, anticorps 4930545J15Rik, anticorps fe11e12, anticorps si:dkey-251e16.4, anticorps tlk1, anticorps wu:fe11e12, anticorps TLK1, anticorps fb76h12, anticorps si:dkey-88m1.1, anticorps wu:fb76h12, anticorps DKFZp459L163, anticorps tousled like kinase 1, anticorps tousled-like kinase 1, anticorps tousled-like kinase 1b, anticorps tousled like kinase 1 like, anticorps serine/threonine-protein kinase TOUSLED, anticorps tousled-like kinase 1a, anticorps Serine/threonine-protein kinase tousled-like 1, anticorps TLK1, anticorps Tlk1, anticorps tlk1b, anticorps TLK1L, anticorps LOC542181, anticorps tlk1a, anticorps tlk1, anticorps tlk-1
- Sujet
- The Tousled-like kinases, first described in Arabadopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.
- Poids moléculaire
- 84 kDa (MW of target protein)
-