KIF13B anticorps (N-Term)

N° du produit ABIN634243

Cet anticorps Lapin Polyclonal détecte spécifiquement KIF13B dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour KIF13B anticorps (N-Term) (ABIN634243)

Antigène: KIF13B (Kinesin Family Member 13B (KIF13B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF13B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KIF13B anticorps

Épitope: N-Term

Specificité: KIF13 B antibody was raised against the N terminal of KIF13

Purification: Affinity purified

Immunogène: KIF13 B antibody was raised using the N terminal of KIF13 corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF13B Blocking Peptide, (ABIN5614345), is also available for use as a blocking control in assays to test for specificity of this KIF13B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF13B

Antigène: KIF13B (Kinesin Family Member 13B (KIF13B))

Autre désignation: KIF13B

Sujet: KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.

Poids moléculaire: 203 kDa (MW of target protein)