KIF13B anticorps (N-Term)

N° du produit ABIN634243

Détail du produit anti-KIF13B anticorps

Antigène: KIF13B (Kinesin Family Member 13B (KIF13B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF13B est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF13 B antibody was raised against the N terminal of KIF13

Purification: Affinity purified

Immunogène: KIF13 B antibody was raised using the N terminal of KIF13 corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF13B Blocking Peptide, catalog no. 33R-8472, is also available for use as a blocking control in assays to test for specificity of this KIF13B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF13B

Antigène: KIF13B (Kinesin Family Member 13B (KIF13B))

Autre désignation: KIF13B (KIF13B Produits)

Synonymes: anticorps kif13b, anticorps xKIF13b, anticorps GAKIN, anticorps 5330429L19Rik, anticorps 6030414C01, anticorps AI429803, anticorps C130021D12Rik, anticorps kinesin family member 13Ba, anticorps kinesin family member 13B L homeolog, anticorps kinesin family member 13B, anticorps kif13ba, anticorps kif13b.L, anticorps KIF13B, anticorps Kif13b

Sujet: KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.

Poids moléculaire: 203 kDa (MW of target protein)