K-RAS anticorps (N-Term)

N° du produit ABIN634246

Cet anticorps Lapin Polyclonal détecte spécifiquement K-RAS dans WB. Il présente une réactivité envers Humain, Rat, Souris et Drosophila melanogaster.

Aperçu rapide pour K-RAS anticorps (N-Term) (ABIN634246)

Antigène: K-RAS (KRAS) (GTPase Kras (KRAS))

Reactivité: Humain, Rat, Souris, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp K-RAS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-K-RAS anticorps

Épitope: N-Term

Specificité: KRAS antibody was raised against the N terminal of KRAS

Purification: Affinity purified

Immunogène: KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KRAS Blocking Peptide, (ABIN5614396), is also available for use as a blocking control in assays to test for specificity of this KRAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur K-RAS

Antigène: K-RAS (KRAS) (GTPase Kras (KRAS))

Autre désignation: KRAS

Sujet: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Poids moléculaire: 22 kDa (MW of target protein)