K-RAS anticorps (N-Term)

N° du produit ABIN634246

Détail du produit anti-K-RAS anticorps

Antigène: K-RAS (KRAS) (GTPase Kras (KRAS))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp K-RAS est non-conjugé

Application: Western Blotting (WB)

Specificité: KRAS antibody was raised against the N terminal of KRAS

Purification: Affinity purified

Immunogène: KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KRAS Blocking Peptide, catalog no. 33R-9058, is also available for use as a blocking control in assays to test for specificity of this KRAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur K-RAS

Antigène: K-RAS (KRAS) (GTPase Kras (KRAS))

Autre désignation: KRAS (KRAS Produits)

Synonymes: anticorps wu:fa04e08, anticorps wu:fc14b12, anticorps wu:fc23g10, anticorps wu:fj89d12, anticorps zgc:85725, anticorps Kras2, anticorps c-Ki-ras, anticorps p21, anticorps C-K-RAS, anticorps CFC2, anticorps K-RAS2A, anticorps K-RAS2B, anticorps K-RAS4A, anticorps K-RAS4B, anticorps KI-RAS, anticorps KRAS1, anticorps KRAS2, anticorps NS, anticorps NS3, anticorps RASK2, anticorps AI929937, anticorps K-ras, anticorps Ki-ras, anticorps Kras-2, anticorps p21B, anticorps ras, anticorps k-ras, anticorps kras, anticorps kras-a, anticorps kras-b, anticorps rask2, anticorps K-RAS, anticorps p21ras, anticorps KRAS proto-oncogene, GTPase, anticorps v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog, anticorps Kirsten rat sarcoma viral oncogene homolog, anticorps semicolonial-7, anticorps Ras family protein, anticorps GTPase KRas, anticorps Kirsten rat sarcoma viral oncogene homolog S homeolog, anticorps KRAS, anticorps kras, anticorps Kras, anticorps smco-7, anticorps PGTG_03066, anticorps Tsp_02666, anticorps Tsp_01642, anticorps rask, anticorps kras.S

Classe de substances: Viral Protein

Sujet: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Poids moléculaire: 22 kDa (MW of target protein)