RBM14 anticorps (N-Term)

N° du produit ABIN634248

Détail du produit anti-RBM14 anticorps

Antigène: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM14 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM14 antibody was raised against the N terminal of RBM14

Purification: Affinity purified

Immunogène: RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM14 Blocking Peptide, catalog no. 33R-10047, is also available for use as a blocking control in assays to test for specificity of this RBM14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM14

Antigène: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Autre désignation: RBM14 (RBM14 Produits)

Sujet: RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway