PARD3 anticorps

N° du produit ABIN634251

Cet anticorps anti-PARD3 est un anticorps Lapin Polyclonal détectant PARD3 dans WB. Adapté pour Humain.

Aperçu rapide pour PARD3 anticorps (ABIN634251)

Antigène: PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARD3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PARD3 anticorps

Purification: Affinity purified

Immunogène: PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARD3 Blocking Peptide, (ABIN938061), is also available for use as a blocking control in assays to test for specificity of this PARD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARD3

Antigène: PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))

Autre désignation: PARD3

Sujet: PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange.

Poids moléculaire: 151 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization