Factor II anticorps

N° du produit ABIN634253

L’anticorps Lapin Polyclonal anti- a été validé pour WB. Il convient pour détecter dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Factor II anticorps (ABIN634253)

Antigène: Factor II

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit

Purification: Affinity purified

Immunogène: Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Factor II Blocking Peptide, (ABIN939531), is also available for use as a blocking control in assays to test for specificity of this Factor II antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Factor II

Sujet: Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia.

Poids moléculaire: 65 kDa (MW of target protein)