Estrogen Receptor alpha anticorps (Middle Region)

N° du produit ABIN634254

Cet anticorps anti-Estrogen Receptor alpha est un anticorps Lapin Polyclonal détectant Estrogen Receptor alpha dans WB. Adapté pour Humain.

Aperçu rapide pour Estrogen Receptor alpha anticorps (Middle Region) (ABIN634254)

Antigène: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Estrogen Receptor alpha est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Estrogen Receptor alpha anticorps

Épitope: Middle Region

Specificité: Estrogen Receptor 1 antibody was raised against the middle region of ESR1

Purification: Affinity purified

Immunogène: Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Estrogen Receptor 1 Blocking Peptide, (ABIN940518), is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Estrogen Receptor alpha

Antigène: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Autre désignation: Estrogen Receptor 1

Sujet: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly