Estrogen Receptor alpha anticorps (Middle Region)
-
- Antigène Voir toutes Estrogen Receptor alpha (ESR1) Anticorps
- Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Estrogen Receptor alpha est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Estrogen Receptor 1 antibody was raised against the middle region of ESR1
- Purification
- Affinity purified
- Immunogène
- Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE
- Top Product
- Discover our top product ESR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Estrogen Receptor 1 Blocking Peptide, catalog no. 33R-5132, is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
- Autre désignation
- Estrogen Receptor 1 (ESR1 Produits)
- Synonymes
- anticorps LOC398734, anticorps AA420328, anticorps AU041214, anticorps ER-alpha, anticorps ER[a], anticorps ERa, anticorps ERalpha, anticorps ESR, anticorps Estr, anticorps Estra, anticorps Nr3a1, anticorps NR3A1, anticorps eralpha, anticorps zfER[a], anticorps ER, anticorps ESRA, anticorps ESTRR, anticorps Era, anticorps akap12, anticorps cb27, anticorps esr1, anticorps fb72g12, anticorps id:ibd1202, anticorps sb:cb27, anticorps si:ch73-192g21.1, anticorps wu:fb72g12, anticorps wu:fc21c03, anticorps Esr, anticorps RNESTROR, anticorps ERALPHA, anticorps er, anticorps esr, anticorps nr3a1, anticorps XER, anticorps era, anticorps esra, anticorps ERbeta, anticorps xesr-1, anticorps xlERalpha1, anticorps xlERalpha2, anticorps ESR1, anticorps estrogen receptor 1 L homeolog, anticorps estrogen receptor 1 (alpha), anticorps estrogen receptor 1, anticorps A kinase (PRKA) anchor protein 12b, anticorps esr1.L, anticorps Esr1, anticorps ESR1, anticorps esr1, anticorps akap12b
- Sujet
- Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.
- Poids moléculaire
- 66 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-