Estrogen Receptor alpha anticorps (Middle Region)

N° du produit ABIN634254

Détail du produit anti-Estrogen Receptor alpha anticorps

Antigène: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Estrogen Receptor alpha est non-conjugé

Application: Western Blotting (WB)

Specificité: Estrogen Receptor 1 antibody was raised against the middle region of ESR1

Purification: Affinity purified

Immunogène: Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Estrogen Receptor 1 Blocking Peptide, catalog no. 33R-5132, is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Estrogen Receptor alpha

Antigène: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Autre désignation: Estrogen Receptor 1 (ESR1 Produits)

Synonymes: anticorps LOC398734, anticorps AA420328, anticorps AU041214, anticorps ER-alpha, anticorps ER[a], anticorps ERa, anticorps ERalpha, anticorps ESR, anticorps Estr, anticorps Estra, anticorps Nr3a1, anticorps NR3A1, anticorps eralpha, anticorps zfER[a], anticorps ER, anticorps ESRA, anticorps ESTRR, anticorps Era, anticorps akap12, anticorps cb27, anticorps esr1, anticorps fb72g12, anticorps id:ibd1202, anticorps sb:cb27, anticorps si:ch73-192g21.1, anticorps wu:fb72g12, anticorps wu:fc21c03, anticorps Esr, anticorps RNESTROR, anticorps ERALPHA, anticorps er, anticorps esr, anticorps nr3a1, anticorps XER, anticorps era, anticorps esra, anticorps ERbeta, anticorps xesr-1, anticorps xlERalpha1, anticorps xlERalpha2, anticorps ESR1, anticorps estrogen receptor 1 L homeolog, anticorps estrogen receptor 1 (alpha), anticorps estrogen receptor 1, anticorps A kinase (PRKA) anchor protein 12b, anticorps esr1.L, anticorps Esr1, anticorps ESR1, anticorps esr1, anticorps akap12b

Sujet: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly