LZTS2 anticorps (N-Term)

N° du produit ABIN634260

Cet anticorps anti-LZTS2 Polyclonal Lapin (ABIN634260) détecte spécifiquement LZTS2 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour LZTS2 anticorps (N-Term) (ABIN634260)

Antigène: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LZTS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LZTS2 anticorps

Épitope: N-Term

Specificité: LZTS2 antibody was raised against the N terminal of LZTS2

Purification: Affinity purified

Immunogène: LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LZTS2 Blocking Peptide, (ABIN938022), is also available for use as a blocking control in assays to test for specificity of this LZTS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LZTS2

Antigène: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Autre désignation: LZTS2

Sujet: LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.

Poids moléculaire: 73 kDa (MW of target protein)