ABCF2 anticorps

N° du produit ABIN634277

L’anticorps anti-ABCF2 Polyclonal Lapin est utilisé pour la détection de ABCF2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour ABCF2 anticorps (ABIN634277)

Antigène: ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABCF2 anticorps

Purification: Affinity purified

Immunogène: ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCF2 Blocking Peptide, (ABIN937399), is also available for use as a blocking control in assays to test for specificity of this ABCF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCF2

Antigène: ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))

Autre désignation: ABCF2

Sujet: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants.

Poids moléculaire: 72 kDa (MW of target protein)