ARL5A anticorps (Middle Region)

N° du produit ABIN634288

Cet anticorps Lapin Polyclonal détecte spécifiquement ARL5A dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour ARL5A anticorps (Middle Region) (ABIN634288)

Antigène: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARL5A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ARL5A anticorps

Épitope: Middle Region

Specificité: ARL5 A antibody was raised against the middle region of ARL5

Purification: Affinity purified

Immunogène: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARL5A Blocking Peptide, (ABIN936120), is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARL5A

Antigène: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Autre désignation: ARL5A

Sujet: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Poids moléculaire: 20 kDa (MW of target protein)