RanBP3 anticorps (N-Term)

N° du produit ABIN634299

Détail du produit anti-RanBP3 anticorps

Antigène: RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RanBP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: RanBP3 antibody was raised against the N terminal of RANBP3

Purification: Affinity purified

Immunogène: RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RanBP3 Blocking Peptide, catalog no. 33R-5623, is also available for use as a blocking control in assays to test for specificity of this RanBP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RanBP3

Antigène: RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))

Autre désignation: RanBP3 (RANBP3 Produits)

Synonymes: anticorps 2610024N24Rik, anticorps AA408221, anticorps ranbp3, anticorps MGC79798, anticorps zgc:63485, anticorps RAN binding protein 3, anticorps RAN binding protein 3 L homeolog, anticorps RAN binding protein 3a, anticorps RANBP3, anticorps Ranbp3, anticorps ranbp3.L, anticorps ranbp3, anticorps ranbp3a

Sujet: RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.

Poids moléculaire: 62 kDa (MW of target protein)