CHN1 anticorps

N° du produit ABIN634308

Détail du produit anti-CHN1 anticorps

Antigène: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHN1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHN1 Blocking Peptide, catalog no. 33R-4728, is also available for use as a blocking control in assays to test for specificity of this CHN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHN1

Antigène: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Autre désignation: CHN1 (ARHGAP2 Produits)

Synonymes: anticorps ARHGAP2, anticorps CHN, anticorps DURS2, anticorps NC, anticorps RHOGAP2, anticorps 0610007I19Rik, anticorps 0710001E19Rik, anticorps 1700112L09Rik, anticorps 2900046J01Rik, anticorps AI413815, anticorps chimaerin, anticorps wu:fr89a09, anticorps zgc:56160, anticorps zgc:92906, anticorps N-chimaerin, anticorps chimerin 1, anticorps chimerin 1 L homeolog, anticorps CHN1, anticorps Chn1, anticorps chn1.L, anticorps chn1

Sujet: CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.

Poids moléculaire: 53 kDa (MW of target protein)