B-Cell Linker anticorps (Middle Region)

N° du produit ABIN634309

Cet anticorps Lapin Polyclonal détecte spécifiquement B-Cell Linker dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour B-Cell Linker anticorps (Middle Region) (ABIN634309)

Antigène: B-Cell Linker (BLNK)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B-Cell Linker est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-B-Cell Linker anticorps

Épitope: Middle Region

Specificité: BLNK antibody was raised against the middle region of BLNK

Purification: Affinity purified

Immunogène: BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BLNK Blocking Peptide, (ABIN5612338), is also available for use as a blocking control in assays to test for specificity of this BLNK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLNK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B-Cell Linker

Antigène: B-Cell Linker (BLNK)

Autre désignation: BLNK

Sujet: This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: BCR Signaling