B-Cell Linker anticorps (Middle Region)
-
- Antigène Voir toutes B-Cell Linker (BLNK) Anticorps
- B-Cell Linker (BLNK)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B-Cell Linker est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BLNK antibody was raised against the middle region of BLNK
- Purification
- Affinity purified
- Immunogène
- BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV
- Top Product
- Discover our top product BLNK Anticorps primaire
-
anti-B-Cell Linker (BLNK) antibody
BLNK Reactivité: Humain, Souris WB, ELISA, IHC, FACS, ICC Hôte: Souris Monoclonal 5G9 unconjugated
anti-B-Cell Linker (BLNK) (AA 65-314) antibodyBLNK Reactivité: Humain WB, IHC, ICC, IP Hôte: Lapin Polyclonal unconjugated
anti-B-Cell Linker (BLNK) (AA 301-400) antibodyBLNK Reactivité: Humain WB, ELISA, PLA Hôte: Souris Monoclonal 1D7 unconjugated
anti-B-Cell Linker (BLNK) (C-Term) antibodyVerified BLNK Reactivité: Humain WB, ELISA, FACS, IF Hôte: Chèvre Polyclonal unconjugated
anti-B-Cell Linker (BLNK) (AA 41-337) antibodyBLNK Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-B-Cell Linker (BLNK) (pTyr96) antibodyBLNK Reactivité: Humain WB, ELISA, IF (p), IHC (p), IF (cc), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-B-Cell Linker (BLNK) (N-Term) antibodyBLNK Reactivité: Humain, Souris WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-B-Cell Linker (BLNK) (pTyr96) antibodyBLNK Reactivité: Humain, Souris WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-B-Cell Linker (BLNK) (AA 150-178) antibodyBLNK Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB18883 unconjugated
anti-B-Cell Linker (BLNK) antibodyBLNK Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BLNK Blocking Peptide, catalog no. 33R-7788, is also available for use as a blocking control in assays to test for specificity of this BLNK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLNK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B-Cell Linker (BLNK)
- Autre désignation
- BLNK (BLNK Produits)
- Synonymes
- anticorps BLNK, anticorps blnk, anticorps MGC147045, anticorps BASH, anticorps Bca, anticorps Ly-57, anticorps Ly57, anticorps Lyw-57, anticorps SLP-65, anticorps AGM4, anticorps BLNK-S, anticorps LY57, anticorps SLP65, anticorps bca, anticorps B-cell linker, anticorps B cell linker, anticorps BLNK, anticorps blnk, anticorps Blnk
- Sujet
- This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- BCR Signaling
-
