RASGEF1A anticorps (N-Term)

N° du produit ABIN634311

Détail du produit anti-RASGEF1A anticorps

Antigène: RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RASGEF1A est non-conjugé

Application: Western Blotting (WB)

Specificité: RASGEF1 A antibody was raised against the N terminal of RASGEF1

Purification: Affinity purified

Immunogène: RASGEF1 A antibody was raised using the N terminal of RASGEF1 corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RASGEF1A Blocking Peptide, catalog no. 33R-9069, is also available for use as a blocking control in assays to test for specificity of this RASGEF1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RASGEF1A

Antigène: RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))

Autre désignation: RASGEF1A (RASGEF1A Produits)

Synonymes: anticorps MGC84301, anticorps CG4853, anticorps 6330404M18Rik, anticorps AI835194, anticorps RasGEF domain family member 1A, anticorps RasGEF domain family member 1A L homeolog, anticorps RasGEF domain family, member 1A, anticorps RASGEF1A, anticorps rasgef1a.L, anticorps rasgef1a, anticorps Rasgef1a

Sujet: RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.

Poids moléculaire: 54 kDa (MW of target protein)