STAMBP anticorps (N-Term)

N° du produit ABIN634314

Détail du produit anti-STAMBP anticorps

Antigène: STAMBP (STAM Binding Protein (STAMBP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAMBP est non-conjugé

Application: Western Blotting (WB)

Specificité: STAMBP antibody was raised against the N terminal of STAMBP

Purification: Affinity purified

Immunogène: STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STAMBP Blocking Peptide, catalog no. 33R-8355, is also available for use as a blocking control in assays to test for specificity of this STAMBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STAMBP

Antigène: STAMBP (STAM Binding Protein (STAMBP))

Autre désignation: STAMBP (STAMBP Produits)

Sujet: Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression.

Poids moléculaire: 48 kDa (MW of target protein)