Galectin 9 anticorps

N° du produit ABIN634316

L’anticorps Lapin Polyclonal anti-Galectin 9 a été validé pour WB. Il convient pour détecter Galectin 9 dans des échantillons de Humain.

Aperçu rapide pour Galectin 9 anticorps (ABIN634316)

Antigène: Galectin 9 (LGALS9) (Lectin, Galactoside-Binding, Soluble, 9 (LGALS9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Galectin 9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Galectin 9 anticorps

Purification: Affinity purified

Immunogène: LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGALS9 Blocking Peptide, (ABIN936170), is also available for use as a blocking control in assays to test for specificity of this LGALS9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Galectin 9

Antigène: Galectin 9 (LGALS9) (Lectin, Galactoside-Binding, Soluble, 9 (LGALS9))

Autre désignation: LGALS9

Sujet: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H+RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency.

Poids moléculaire: 39 kDa (MW of target protein)