SNX5 anticorps (N-Term)

N° du produit ABIN634321

Cet anticorps Lapin Polyclonal détecte spécifiquement SNX5 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour SNX5 anticorps (N-Term) (ABIN634321)

Antigène: SNX5 (Sorting Nexin 5 (SNX5))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNX5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SNX5 anticorps

Épitope: N-Term

Specificité: SNX5 antibody was raised against the N terminal of SNX5

Purification: Affinity purified

Immunogène: SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNX5 Blocking Peptide, (ABIN938512), is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNX5

Antigène: SNX5 (Sorting Nexin 5 (SNX5))

Autre désignation: SNX5

Sujet: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.

Poids moléculaire: 47 kDa (MW of target protein)