NCF4 anticorps (N-Term)

N° du produit ABIN634325

L’anticorps Lapin Polyclonal anti-NCF4 a été validé pour WB. Il convient pour détecter NCF4 dans des échantillons de Humain.

Aperçu rapide pour NCF4 anticorps (N-Term) (ABIN634325)

Antigène: NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NCF4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NCF4 anticorps

Épitope: N-Term

Specificité: NCF4 antibody was raised against the N terminal of NCF4

Purification: Affinity purified

Immunogène: NCF4 antibody was raised using the N terminal of NCF4 corresponding to a region with amino acids SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NCF4 Blocking Peptide, (ABIN5614929), is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NCF4

Antigène: NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))

Autre désignation: NCF4

Sujet: NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.

Poids moléculaire: 39 kDa (MW of target protein)