Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (Middle Region) anticorps

N° du produit ABIN634326

Détail du produit

Antigène:

Neutrophil Cytosolic Factor 4, 40kDa (NCF4)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: NCF4 antibody was raised against the middle region of NCF4

Purification: Affinity purified

Immunogène: NCF4 antibody was raised using the middle region of NCF4 corresponding to a region with amino acids TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NCF4 Blocking Peptide, catalog no. 33R-9086, is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène:

Neutrophil Cytosolic Factor 4, 40kDa (NCF4)

Autre désignation: NCF4 (NCF4 Antibody Extrait)

Synonymes: p40phox, AI451400, NCF, P40PHOX, SH3PXD4, neutrophil cytosolic factor 4, ncf4, Ncf4, NCF4

Sujet: NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.

Poids moléculaire: 39 kDa (MW of target protein)