RHOU anticorps (C-Term)

N° du produit ABIN634330

Cet anticorps Lapin Polyclonal détecte spécifiquement RHOU dans WB. Il présente une réactivité envers Humain et Rat.

Aperçu rapide pour RHOU anticorps (C-Term) (ABIN634330)

Antigène: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOU est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RHOU anticorps

Épitope: C-Term

Specificité: RHOU antibody was raised against the C terminal of RHOU

Purification: Affinity purified

Immunogène: RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOU Blocking Peptide, (ABIN940472), is also available for use as a blocking control in assays to test for specificity of this RHOU antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOU

Antigène: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Autre désignation: RHOU

Sujet: RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.

Poids moléculaire: 28 kDa (MW of target protein)