RHOU anticorps (C-Term)

N° du produit ABIN634330

Détail du produit anti-RHOU anticorps

Antigène: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOU est non-conjugé

Application: Western Blotting (WB)

Specificité: RHOU antibody was raised against the C terminal of RHOU

Purification: Affinity purified

Immunogène: RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOU Blocking Peptide, catalog no. 33R-5086, is also available for use as a blocking control in assays to test for specificity of this RHOU antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOU

Antigène: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Autre désignation: RHOU (RHOU Produits)

Synonymes: anticorps ARHU, anticorps CDC42L1, anticorps DJ646B12.2, anticorps WRCH1, anticorps fJ646B12.2, anticorps hG28K, anticorps 2310026M05Rik, anticorps AI182090, anticorps Arhu, anticorps G28K, anticorps WRCH-1, anticorps mG28K, anticorps arhu, anticorps hg28k, anticorps wrch1, anticorps wrch-1, anticorps cdc42l1, anticorps MGC107947, anticorps fj646b12.2, anticorps zgc:101642, anticorps wu:fb18g01, anticorps zgc:110357, anticorps Wrch, anticorps rac-2, anticorps rhou, anticorps xg28k, anticorps ras homolog family member U, anticorps ras homolog gene family, member U, anticorps ras homolog family member Ua, anticorps ras homolog family member Ub, anticorps ras homolog family member U L homeolog, anticorps RHOU, anticorps Rhou, anticorps rhou, anticorps rhoua, anticorps rhoub, anticorps rhou.L

Sujet: RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.

Poids moléculaire: 28 kDa (MW of target protein)