SKAP1 anticorps (N-Term)

N° du produit ABIN634334

Détail du produit anti-SKAP1 anticorps

Antigène: SKAP1 (Src Kinase Associated phosphoprotein 1 (SKAP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SKAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SKAP1 antibody was raised against the N terminal of SKAP1

Purification: Affinity purified

Immunogène: SKAP1 antibody was raised using the N terminal of SKAP1 corresponding to a region with amino acids RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SKAP1 Blocking Peptide, catalog no. 33R-7848, is also available for use as a blocking control in assays to test for specificity of this SKAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SKAP1

Antigène: SKAP1 (Src Kinase Associated phosphoprotein 1 (SKAP1))

Autre désignation: SKAP1 (SKAP1 Produits)

Synonymes: anticorps 1700091G21Rik, anticorps Scap1, anticorps Skap-55, anticorps SCAP1, anticorps SKAP55, anticorps Skap55, anticorps src family associated phosphoprotein 1, anticorps src kinase associated phosphoprotein 1, anticorps Skap1, anticorps SKAP1

Sujet: SKAP1 Is a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

Poids moléculaire: 41 kDa (MW of target protein)