SHB anticorps (N-Term)

N° du produit ABIN634335

Détail du produit anti-SHB anticorps

Antigène: SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SHB est non-conjugé

Application: Western Blotting (WB)

Specificité: SHB antibody was raised against the N terminal of SHB

Purification: Affinity purified

Immunogène: SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SHB Blocking Peptide, catalog no. 33R-2710, is also available for use as a blocking control in assays to test for specificity of this SHB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SHB

Antigène: SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))

Autre désignation: SHB (SHB Produits)

Synonymes: anticorps SHB, anticorps RP11-3J10.8, anticorps bA3J10.2, anticorps RGD1565350, anticorps BC028832, anticorps SH2 domain containing adaptor protein B, anticorps src homology 2 domain-containing transforming protein B, anticorps SHB, anticorps Shb

Sujet: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Poids moléculaire: 55 kDa (MW of target protein)