DVL2 anticorps

N° du produit ABIN634352

L’anticorps Lapin Polyclonal anti-DVL2 a été validé pour WB. Il convient pour détecter DVL2 dans des échantillons de Humain et Souris.

Aperçu rapide pour DVL2 anticorps (ABIN634352)

Antigène: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DVL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DVL2 anticorps

Purification: Affinity purified

Immunogène: DVL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DVL2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DVL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DVL2

Antigène: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Autre désignation: DVL2

Sujet: DVL2 is a member of the dishevelled (dsh) protein family. It is a 90 kDa protein that undergoes posttranslational phosphorylation to form a 95 kDa cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Poids moléculaire: 79 kDa (MW of target protein)

Pathways: Tube Formation