MAP4K2 anticorps (N-Term)

N° du produit ABIN634356

Cet anticorps anti-MAP4K2 Polyclonal Lapin (ABIN634356) détecte spécifiquement MAP4K2 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour MAP4K2 anticorps (N-Term) (ABIN634356)

Antigène: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP4K2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAP4K2 anticorps

Épitope: N-Term

Specificité: MAP4 K2 antibody was raised against the N terminal of MAP4 2

Purification: Affinity purified

Immunogène: MAP4 K2 antibody was raised using the N terminal of MAP4 2 corresponding to a region with amino acids TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP4K2 Blocking Peptide, (ABIN5614655), is also available for use as a blocking control in assays to test for specificity of this MAP4K2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP4K2

Antigène: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Autre désignation: MAP4K2

Sujet: MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Poids moléculaire: 91 kDa (MW of target protein)