MAP4K4 anticorps (N-Term)

N° du produit ABIN634358

L’anticorps Lapin Polyclonal anti-MAP4K4 a été validé pour WB. Il convient pour détecter MAP4K4 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour MAP4K4 anticorps (N-Term) (ABIN634358)

Antigène: MAP4K4 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP4K4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAP4K4 anticorps

Épitope: N-Term

Specificité: MAP4 K4 antibody was raised against the N terminal of MAP4 4

Purification: Affinity purified

Immunogène: MAP4 K4 antibody was raised using the N terminal of MAP4 4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP4K4 Blocking Peptide, (ABIN5614656), is also available for use as a blocking control in assays to test for specificity of this MAP4K4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP4K4

Antigène: MAP4K4 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4))

Autre désignation: MAP4K4

Sujet: MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.

Poids moléculaire: 133 kDa (MW of target protein)