RAB23 anticorps (N-Term)

N° du produit ABIN634360

Cet anticorps Lapin Polyclonal détecte spécifiquement RAB23 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour RAB23 anticorps (N-Term) (ABIN634360)

Antigène: RAB23 (RAB23, Member RAS Oncogene Family (RAB23))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB23 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB23 anticorps

Épitope: N-Term

Specificité: RAB23 antibody was raised against the N terminal of RAB23

Purification: Affinity purified

Immunogène: RAB23 antibody was raised using the N terminal of RAB23 corresponding to a region with amino acids TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB23 Blocking Peptide, (ABIN5615700), is also available for use as a blocking control in assays to test for specificity of this RAB23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB23

Antigène: RAB23 (RAB23, Member RAS Oncogene Family (RAB23))

Autre désignation: RAB23

Sujet: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Tube Formation