CD160 anticorps (Middle Region)

N° du produit ABIN634374

Cet anticorps anti-CD160 Polyclonal Lapin (ABIN634374) détecte spécifiquement CD160 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour CD160 anticorps (Middle Region) (ABIN634374)

Antigène: CD160

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD160 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CD160 anticorps

Épitope: Middle Region

Specificité: CD160 antibody was raised against the middle region of CD160

Purification: Affinity purified

Immunogène: CD160 antibody was raised using the middle region of CD160 corresponding to a region with amino acids SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CD160 Blocking Peptide, (ABIN5612745), is also available for use as a blocking control in assays to test for specificity of this CD160 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CD160

Antigène: CD160

Autre désignation: CD160

Sujet: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity.

Poids moléculaire: 20 kDa (MW of target protein)