GUCY1B3 anticorps (N-Term)

N° du produit ABIN634375

Cet anticorps Lapin Polyclonal détecte spécifiquement GUCY1B3 dans WB. Il présente une réactivité envers Humain, Souris et Chien.

Aperçu rapide pour GUCY1B3 anticorps (N-Term) (ABIN634375)

Antigène: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GUCY1B3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GUCY1B3 anticorps

Épitope: N-Term

Specificité: GUCY1 B3 antibody was raised against the N terminal of GUCY1 3

Purification: Affinity purified

Immunogène: GUCY1 B3 antibody was raised using the N terminal of GUCY1 3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GUCY1B3 Blocking Peptide, (ABIN940427), is also available for use as a blocking control in assays to test for specificity of this GUCY1B3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUCY0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GUCY1B3

Antigène: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Autre désignation: GUCY1B3

Sujet: Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis