DGKA anticorps (N-Term)

N° du produit ABIN634379

L’anticorps Lapin Polyclonal anti-DGKA a été validé pour WB. Il convient pour détecter DGKA dans des échantillons de Humain.

Aperçu rapide pour DGKA anticorps (N-Term) (ABIN634379)

Antigène: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGKA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DGKA anticorps

Épitope: N-Term

Specificité: DGKA antibody was raised against the N terminal of DGKA

Purification: Affinity purified

Immunogène: DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGKA Blocking Peptide, (ABIN937817), is also available for use as a blocking control in assays to test for specificity of this DGKA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGKA

Antigène: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Autre désignation: DGKA

Sujet: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways.

Poids moléculaire: 83 kDa (MW of target protein)