CANT1 anticorps (Middle Region)

N° du produit ABIN634381

Détail du produit anti-CANT1 anticorps

Antigène: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CANT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CANT1 antibody was raised against the middle region of CANT1

Purification: Affinity purified

Immunogène: CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CANT1 Blocking Peptide, catalog no. 33R-8666, is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CANT1

Antigène: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Autre désignation: CANT1 (CANT1 Produits)

Synonymes: anticorps DBQD, anticorps SCAN-1, anticorps SCAN1, anticorps SHAPY, anticorps 5830420C20Rik, anticorps Apy1h, anticorps D11Bwg0554e, anticorps Entpd8, anticorps Shapy, anticorps srapy, anticorps apyrase, anticorps xapy, anticorps cant1, anticorps entpd8, anticorps zgc:85724, anticorps CANT1, anticorps zgc:101021, anticorps calcium activated nucleotidase 1, anticorps calcium activated nucleotidase 1 L homeolog, anticorps calcium activated nucleotidase 1a, anticorps calcium activated nucleotidase 1b, anticorps CANT1, anticorps Cant1, anticorps cant1.L, anticorps cant1, anticorps cant1a, anticorps LOAG_01305, anticorps cant1b

Sujet: CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

Poids moléculaire: 45 kDa (MW of target protein)