CANT1 anticorps (Middle Region)

N° du produit ABIN634381

Cet anticorps Lapin Polyclonal détecte spécifiquement CANT1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CANT1 anticorps (Middle Region) (ABIN634381)

Antigène: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CANT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CANT1 anticorps

Épitope: Middle Region

Specificité: CANT1 antibody was raised against the middle region of CANT1

Purification: Affinity purified

Immunogène: CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CANT1 Blocking Peptide, (ABIN5612599), is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CANT1

Antigène: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Autre désignation: CANT1

Sujet: CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

Poids moléculaire: 45 kDa (MW of target protein)