OTUD6B anticorps (Middle Region)

N° du produit ABIN634385

L’anticorps Lapin Polyclonal anti-OTUD6B a été validé pour WB. Il convient pour détecter OTUD6B dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour OTUD6B anticorps (Middle Region) (ABIN634385)

Antigène: OTUD6B (OTU Domain Containing 6B (OTUD6B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTUD6B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OTUD6B anticorps

Épitope: Middle Region

Specificité: OTUD6 B antibody was raised against the middle region of OTUD6

Purification: Affinity purified

Immunogène: OTUD6 B antibody was raised using the middle region of OTUD6 corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OTUD6B Blocking Peptide, (ABIN937859), is also available for use as a blocking control in assays to test for specificity of this OTUD6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OTUD6B

Antigène: OTUD6B (OTU Domain Containing 6B (OTUD6B))

Autre désignation: OTUD6B

Sujet: Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Poids moléculaire: 37 kDa (MW of target protein)