RAB5 anticorps (Middle Region)

N° du produit ABIN634386

Cet anticorps anti-RAB5 est un anticorps Lapin Polyclonal détectant RAB5 dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour RAB5 anticorps (Middle Region) (ABIN634386)

Antigène: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB5 anticorps

Épitope: Middle Region

Specificité: RAB5 A antibody was raised against the middle region of RAB5

Purification: Affinity purified

Immunogène: RAB5 A antibody was raised using the middle region of RAB5 corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB5A Blocking Peptide, (ABIN940077), is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB5

Antigène: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Autre désignation: RAB5A

Sujet: RAB5A is required for the fusion of plasma membranes and early endosomes.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity