RAB5 anticorps (Middle Region)
-
- Antigène Voir toutes RAB5 (RAB5A) Anticorps
- RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAB5 A antibody was raised against the middle region of RAB5
- Purification
- Affinity purified
- Immunogène
- RAB5 A antibody was raised using the middle region of RAB5 corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS
- Top Product
- Discover our top product RAB5A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB5A Blocking Peptide, catalog no. 33R-4691, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))
- Autre désignation
- RAB5A (RAB5A Produits)
- Synonymes
- anticorps RAB5, anticorps 2410015H04Rik, anticorps AI663973, anticorps AU021172, anticorps nnyRab5a, anticorps DDBDRAFT_0168594, anticorps DDBDRAFT_0229401, anticorps DDB_0168594, anticorps DDB_0229401, anticorps rab5, anticorps RAB5A, anticorps Rab5a, anticorps rab5al, anticorps zgc:56644, anticorps fj38g08, anticorps hm:zehn1144, anticorps rab5a, anticorps wu:fj38g08, anticorps RAB5A, member RAS oncogene family, anticorps rab5A protein, anticorps Rab5a, GTPase, anticorps predicted protein, anticorps Rab GTPase, anticorps RAB5A, member RAS oncogene family L homeolog, anticorps RAB5A, member RAS oncogene family, b, anticorps RAB5A, member RAS oncogene family, a, anticorps RAB5A, anticorps Rab5a, anticorps rab5A, anticorps rab5a, anticorps rab5a.L, anticorps rab5ab, anticorps rab5aa
- Sujet
- RAB5A is required for the fusion of plasma membranes and early endosomes.
- Poids moléculaire
- 24 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity
-